HHsearch alignment for GI: 255764460 and conserved domain: CHL00131

>CHL00131 ycf16 sulfate ABC transporter protein; Validated.
Probab=95.70  E-value=0.02  Score=34.91  Aligned_cols=54  Identities=28%  Similarity=0.405  Sum_probs=34.8

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHH--HHHHCCCEEEEEECCC--CCCHHHHHHHCC
Q ss_conf             726880799970687237899999987--5200898799997388--556688998198
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIA--QSQKTGGTCAFVDAEH--ALDSIYARKLGV  117 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a--~~qk~g~~~~~iD~E~--~~~~~~a~~~Gv  117 (363)
T Consensus        28 ~i~~Gei~aiiG~nGsGKSTL~~~i~G~~~~~~~~G~I-~~~G~~i~~~~~~~~~~~gi   85 (252)
T CHL00131         28 SINAGEIHAIMGPNGSGKSTLSKVIAGHPAYTVLEGDI-LFKGESILELEPEERAHLGI   85 (252)
T ss_pred             EECCCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCEE-EECCEECCCCCHHHHHHCCE
T ss_conf             88799899999999999999999972787667664259-98772768599999986596