HHsearch alignment for GI: 255764460 and conserved domain: COG0410

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].
Probab=96.34  E-value=0.023  Score=34.49  Aligned_cols=139  Identities=22%  Similarity=0.316  Sum_probs=72.7

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECC--CCCCHHHHHHHCCC--HHHEEEEECCCHHHHHHHHH
Q ss_conf             726880799970687237899999987520089879999738--85566889981988--33448972584899999999
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE--HALDSIYARKLGVD--LKNLLISQPDTGEQALEITD  138 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E--~~~~~~~a~~~Gvd--~~~l~~~~~~~~E~~~~i~~  138 (363)
T Consensus        25 ~v~~Geiv~llG~NGaGKTTlLkti~Gl~~~~~G~I~~-~G~dit~~p~~~r~r~Gi~~VPegR~iF~~LTVeENL~~g~  103 (237)
T COG0410          25 EVERGEIVALLGRNGAGKTTLLKTIMGLVRPRSGRIIF-DGEDITGLPPHERARLGIAYVPEGRRIFPRLTVEENLLLGA  103 (237)
T ss_pred             EECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEE-CCEECCCCCHHHHHHCCEEECCCCCCCHHHCCHHHHHHHHH
T ss_conf             87689889998999888899999985898788706998-98356779978998577686752136100075999874231


Q ss_pred             HHHHCCCCCEEEEECCCCCCCH-HHHHHH----H--HHHCC---------------------CHHHHHHHHHHHHHHHHH
Q ss_conf             9974489768998143332202-655434----5--55302---------------------247888767767777642
Q gi|255764460|r  139 MLVRSGAVDIIVIDSVAALTPR-AEIEGD----M--GESLP---------------------GMQARLMSQALRKLTSSI  190 (363)
Q Consensus       139 ~li~~~~~~liViDSi~al~p~-~Eie~~----~--~d~~~---------------------g~~ar~ms~~lrkl~~~~  190 (363)
T Consensus       104 ~~~~~~~~~~~~~e~v~~lFP~Lker~~~~aG~LSGGEQQMLAiaRALm~~PklLLLDEPs~GLaP~iv~~I~~~i~~l~  183 (237)
T COG0410         104 YARRDKEAQERDLEEVYELFPRLKERRNQRAGTLSGGEQQMLAIARALMSRPKLLLLDEPSEGLAPKIVEEIFEAIKELR  183 (237)
T ss_pred             HCCCCCCCCCCCHHHHHHHCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             02453100011389999978638988408446778199999999999961998899658866768899999999999999


Q ss_pred             CCCCCEEEEEEC
Q ss_conf             017818999863
Q gi|255764460|r  191 SRSKCILVFINQ  202 (363)
Q Consensus       191 ~k~~~~~i~iNQ  202 (363)
T Consensus       184 ~~~g~tIlLVEQ  195 (237)
T COG0410         184 KEGGMTILLVEQ  195 (237)
T ss_pred             HCCCCEEEEEEC
T ss_conf             748948999942