HHsearch alignment for GI: 255764460 and conserved domain: COG0593

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair].
Probab=96.40  E-value=0.023  Score=34.54  Aligned_cols=102  Identities=21%  Similarity=0.268  Sum_probs=60.1

Q ss_pred             CCCCCCHHHHHHHC-----CCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCC--EEEEEECCCCCCHHHHHH-----
Q ss_conf             01477278999723-----897268807999706872378999999875200898--799997388556688998-----
Q gi|255764460|r   47 VVSSGSLGLDIALG-----IGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGG--TCAFVDAEHALDSIYARK-----  114 (363)
Q Consensus        47 ~i~TG~~~lD~~Lg-----~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~--~~~~iD~E~~~~~~~a~~-----  114 (363)
T Consensus        89 Fv~g~~N~~A~aa~~~va~~~g~~~npl-fi~G~~GlGKTHLl~Aign~~~~~~~~a~v~y~~se~f~~-~~v~a~~~~~  166 (408)
T COG0593          89 FVVGPSNRLAYAAAKAVAENPGGAYNPL-FIYGGVGLGKTHLLQAIGNEALANGPNARVVYLTSEDFTN-DFVKALRDNE  166 (408)
T ss_pred             EEECCCHHHHHHHHHHHHHCCCCCCCCE-EEECCCCCCHHHHHHHHHHHHHHHCCCCEEEECCHHHHHH-HHHHHHHHHH
T ss_conf             2047744999999999875668868957-9987999978999999999998629986488504899899-9999988504


Q ss_pred             -------HCCC---HHHEEE--EECCCHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             -------1988---334489--7258489999999999744897689981
Q gi|255764460|r  115 -------LGVD---LKNLLI--SQPDTGEQALEITDMLVRSGAVDIIVID  152 (363)
Q Consensus       115 -------~Gvd---~~~l~~--~~~~~~E~~~~i~~~li~~~~~~liViD  152 (363)
T Consensus       167 ~~~Fk~~y~~dlllIDDiq~l~gk~~~qeefFh~FN~l~~~~k--qIvlt  214 (408)
T COG0593         167 MEKFKEKYSLDLLLIDDIQFLAGKERTQEEFFHTFNALLENGK--QIVLT  214 (408)
T ss_pred             HHHHHHHHCCCEEEECHHHHHCCCHHHHHHHHHHHHHHHHCCC--EEEEE
T ss_conf             8888876426735551386756771579999999998885088--79997