HHsearch alignment for GI: 255764460 and conserved domain: COG1116

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].
Probab=96.07  E-value=0.009  Score=37.11  Aligned_cols=40  Identities=38%  Similarity=0.561  Sum_probs=29.7

Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             26880799970687237899999987520089879999738
Q gi|255764460|r   64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE  104 (363)
Q Consensus        64 ~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E  104 (363)
T Consensus        26 v~~GEfvsilGpSGcGKSTL-LriiAGL~~p~~G~V~~~g~   65 (248)
T COG1116          26 VEKGEFVAILGPSGCGKSTL-LRLIAGLEKPTSGEVLLDGR   65 (248)
T ss_pred             ECCCCEEEEECCCCCCHHHH-HHHHHCCCCCCCCEEEECCC
T ss_conf             77997999989997889999-99996878777755998882