HHsearch alignment for GI: 255764460 and conserved domain: COG1129

>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].
Probab=97.20  E-value=0.011  Score=36.45  Aligned_cols=54  Identities=17%  Similarity=0.264  Sum_probs=37.3

Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCC--CCHHHHHHHCCC
Q ss_conf             2688079997068723789999998752008987999973885--566889981988
Q gi|255764460|r   64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHA--LDSIYARKLGVD  118 (363)
Q Consensus        64 ~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~--~~~~~a~~~Gvd  118 (363)
T Consensus        31 v~~GEV~aL~GeNGAGKSTLm-KiLsGv~~p~~G~I~~~G~~~~~~sp~~A~~~GI~   86 (500)
T COG1129          31 VRPGEVHALLGENGAGKSTLM-KILSGVYPPDSGEILIDGKPVAFSSPRDALAAGIA   86 (500)
T ss_pred             EECCEEEEEECCCCCCHHHHH-HHHHCCCCCCCCEEEECCEECCCCCHHHHHHCCEE
T ss_conf             837728999668888899999-99728615886179999988068999999868908