HHsearch alignment for GI: 255764460 and conserved domain: COG1157

>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion].
Probab=97.55  E-value=0.00058  Score=44.65  Aligned_cols=124  Identities=24%  Similarity=0.314  Sum_probs=77.2

Q ss_pred             CCCCCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCC-CCHHHHHH-HCCC-
Q ss_conf             34655014772789997238972688079997068723789999998752008987999973885-56688998-1988-
Q gi|255764460|r   42 FEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHA-LDSIYARK-LGVD-  118 (363)
Q Consensus        42 ~~~~~~i~TG~~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~-~~~~~a~~-~Gvd-  118 (363)
T Consensus       141 ~~I~~~l~tGVRaIDgllT~G---~GQRiGIFAgsGVGKStLL-gMiar~t~aDv~ViaLIGERGREVrEFIE~~Lg~eg  216 (441)
T COG1157         141 RPIEEPLDTGVRAIDGLLTCG---KGQRIGIFAGSGVGKSTLL-GMIARNTEADVNVIALIGERGREVREFIEKDLGEEG  216 (441)
T ss_pred             CCCCCCCCCCCEEEECCCCCC---CCCEEEEEECCCCCHHHHH-HHHHCCCCCCEEEEEEEECCCHHHHHHHHHHCCHHH
T ss_conf             654664545614440100224---6746788716998689999-999624669879999760664059999998602330


Q ss_pred             HHHE-EEE-ECCC--------HHHHHHHHHHHHHCCCCCEEEEECCCCCC-CHHHHHHHHHH
Q ss_conf             3344-897-2584--------89999999999744897689981433322-02655434555
Q gi|255764460|r  119 LKNL-LIS-QPDT--------GEQALEITDMLVRSGAVDIIVIDSVAALT-PRAEIEGDMGE  169 (363)
Q Consensus       119 ~~~l-~~~-~~~~--------~E~~~~i~~~li~~~~~~liViDSi~al~-p~~Eie~~~~d  169 (363)
T Consensus       217 l~rsViVvATSD~s~l~R~~aa~~At~IAEyFRDqG~~VLL~mDSlTRfA~AqREI~LA~GE  278 (441)
T COG1157         217 LKRSVVVVATSDESALMRLKAAFTATTIAEYFRDQGKRVLLIMDSLTRFAMAQREIGLAAGE  278 (441)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHHHHHHCCC
T ss_conf             35269999789889899988899999999999867985999961388999999888875289