HHsearch alignment for GI: 255764460 and conserved domain: COG1703

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism].
Probab=96.33  E-value=0.081  Score=31.07  Aligned_cols=97  Identities=24%  Similarity=0.384  Sum_probs=63.1

Q ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEE--ECCCCC-------CHHHHHHHCCCHHHEEEEECCC---HH--
Q ss_conf             880799970687237899999987520089879999--738855-------6688998198833448972584---89--
Q gi|255764460|r   66 KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFV--DAEHAL-------DSIYARKLGVDLKNLLISQPDT---GE--  131 (363)
Q Consensus        66 ~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~i--D~E~~~-------~~~~a~~~Gvd~~~l~~~~~~~---~E--  131 (363)
T Consensus        50 ~a~viGITG~PGaGKSTli~~L~~~l~~~G~rVaVlAVDPSSp~TGGsiLGDRiRM~~~~~~~~vFiRs~~srG~lGGlS  129 (323)
T COG1703          50 NAHVIGITGVPGAGKSTLIEALGRELRERGHRVAVLAVDPSSPFTGGSILGDRIRMQRLAVDPGVFIRSSPSRGTLGGLS  129 (323)
T ss_pred             CCCEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHHHHHHCCCCCEEEEECCCCCCCHHHH
T ss_conf             98378731799886688999999999977967899998899998785301207667764469981784268776510166


Q ss_pred             -HHHHHHHHHHHCCCCCEEEEECCCCCCCHHHH
Q ss_conf             -99999999974489768998143332202655
Q gi|255764460|r  132 -QALEITDMLVRSGAVDIIVIDSVAALTPRAEI  163 (363)
Q Consensus       132 -~~~~i~~~li~~~~~~liViDSi~al~p~~Ei  163 (363)
T Consensus       130 ~at~~~i-~~ldAaG~DvIIVETVGvGQsev~I  161 (323)
T COG1703         130 RATREAI-KLLDAAGYDVIIVETVGVGQSEVDI  161 (323)
T ss_pred             HHHHHHH-HHHHHCCCCEEEEEECCCCCCHHHH
T ss_conf             8899999-9998618988999814788415577