HHsearch alignment for GI: 255764460 and conserved domain: COG2894

>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].
Probab=95.68  E-value=0.12  Score=30.00  Aligned_cols=87  Identities=28%  Similarity=0.271  Sum_probs=59.1

Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCH-HH---HHHH----CCC-----------------HHHEE
Q ss_conf             79997068723789999998752008987999973885566-88---9981----988-----------------33448
Q gi|255764460|r   69 IVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDS-IY---ARKL----GVD-----------------LKNLL  123 (363)
Q Consensus        69 i~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~~~-~~---a~~~----Gvd-----------------~~~l~  123 (363)
T Consensus         5 IVvTSGKGGVGKTTttAnig~aLA~~GkKv~liD~DiGLRNLDlimGlE~RiVYd~vdVi~g~~~l~QALIkDKr~~nL~   84 (272)
T COG2894           5 IVVTSGKGGVGKTTTTANIGTALAQLGKKVVLIDFDIGLRNLDLIMGLENRIVYDLVDVIEGEATLNQALIKDKRLENLF   84 (272)
T ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHCCCCEEEEEEHHHHCCCCCHHHHHHCCCCCCCEE
T ss_conf             99944888767431067789999973985999966767204466643420156540134447663656764035678526


Q ss_pred             EEEC--------CCHHHHHHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             9725--------84899999999997448976899814333
Q gi|255764460|r  124 ISQP--------DTGEQALEITDMLVRSGAVDIIVIDSVAA  156 (363)
Q Consensus       124 ~~~~--------~~~E~~~~i~~~li~~~~~~liViDSi~a  156 (363)
T Consensus        85 lLPAsQtrdKdalt~E~v~~vv~eL~~-~~fDyIi~DsPAG  124 (272)
T COG2894          85 LLPASQTRDKDALTPEGVKKVVNELKA-MDFDYIIIDSPAG  124 (272)
T ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHH-CCCCEEEECCCCH
T ss_conf             614432367222799999999999976-6998899648406