HHsearch alignment for GI: 255764460 and conserved domain: COG3839

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism].
Probab=95.79  E-value=0.013  Score=36.16  Aligned_cols=41  Identities=29%  Similarity=0.503  Sum_probs=30.9

Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             268807999706872378999999875200898799997388
Q gi|255764460|r   64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEH  105 (363)
Q Consensus        64 ~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~  105 (363)
T Consensus        26 i~~Gef~vllGPSGcGKSTl-Lr~IAGLe~p~~G~I~i~g~~   66 (338)
T COG3839          26 IEDGEFVVLLGPSGCGKSTL-LRMIAGLEEPTSGEILIDGRD   66 (338)
T ss_pred             ECCCCEEEEECCCCCCHHHH-HHHHHCCCCCCCCEEEECCEE
T ss_conf             74797999989998888999-999968877887159999999