HHsearch alignment for GI: 255764460 and conserved domain: COG4544

>COG4544 Uncharacterized conserved protein [Function unknown].
Probab=98.34  E-value=2e-06  Score=60.20  Aligned_cols=191  Identities=19%  Similarity=0.246  Sum_probs=119.4

Q ss_pred             CCCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCHHHHH--HHHHHHHHHHCCCEEEEEECC-CCCCHHHHHHHCCCHH
Q ss_conf             6550147727899972389726880799970687237899--999987520089879999738-8556688998198833
Q gi|255764460|r   44 GIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTL--ALHTIAQSQKTGGTCAFVDAE-HALDSIYARKLGVDLK  120 (363)
Q Consensus        44 ~~~~i~TG~~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtl--al~~~a~~qk~g~~~~~iD~E-~~~~~~~a~~~Gvd~~  120 (363)
T Consensus        31 ~~~~LpfGvp~~Da~lpGGglalg~ihe~~ggg~ga~~GaAaAl~~~g~~~r~~gpVvWi~tr~dlf~pa-L~~~Gl~~~  109 (260)
T COG4544          31 RAGILPFGVPPIDAALPGGGLALGEIHELEGGGAGAADGAAAALAVLGLAARRGGPVVWILTREDLFPPA-LAAFGLDPE  109 (260)
T ss_pred             CCCCCCCCCCCHHHHCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHH-HHHCCCCHH
T ss_conf             4650036887133226786155555651167774102307999998754104579879998533346403-755389943


Q ss_pred             HEEEEECCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             44897258489999999999744897689981433322026554345553022478887677677776420178189998
Q gi|255764460|r  121 NLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFI  200 (363)
Q Consensus       121 ~l~~~~~~~~E~~~~i~~~li~~~~~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k~~~~~i~i  200 (363)
T Consensus       110 RlifVea~~e~dvL~~~EeaLs~~g~aaVV~----------Ei~-----------~L~lt-asRRLqlaae~~G~~~l~l  167 (260)
T COG4544         110 RLIFVEARKEEDVLWNAEEALSFGGLAAVVA----------EIR-----------RLDLT-ASRRLQLAAEAAGVPGLVL  167 (260)
T ss_pred             HEEEEECCCHHHHHHHHHHHHCCCCHHHEEE----------EEE-----------ECCCC-HHHHHHHHHHHCCCCEEEE
T ss_conf             5899867708889999987631464431245----------444-----------14531-4478899987459837999


Q ss_pred             E-CCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEE-EEEEEEEECCCCCCCCEEEEEEEC
Q ss_conf             6-34114566546651256553111111248975045534457724767-999877405778985158999861
Q gi|255764460|r  201 N-QMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGN-QTRVKVVKNKMASPFKQVEFDIMY  272 (363)
Q Consensus       201 N-Q~r~~ig~m~g~p~~~~GG~al~~~aS~rl~i~k~~~ik~~~~~iG~-~v~~kv~Knk~~~P~~~a~~~i~f  272 (363)
T Consensus       168 Rrr~~e--~~~~g~p~------a--~vsrwri~~~Ps~~~p--~~gvGrP~w~lel~r~R~g~~---g~f~lea  226 (260)
T COG4544         168 RRRAAE--AEAFGQPT------A--AVSRWRISPRPSEPLP--VPGVGRPAWFLELERSRAGEC---GEFILEA  226 (260)
T ss_pred             ECCCCC--CCCCCCCC------C--EECCCCCCCCCCCCCC--CCCCCCCHHHHHHHHHCCCCC---CCEEEEE
T ss_conf             614577--65456852------2--0034423457888899--998876026675355326888---5168983