HHsearch alignment for GI: 255764460 and conserved domain: KOG0652

>KOG0652 consensus.
Probab=95.39  E-value=0.13  Score=29.69  Aligned_cols=118  Identities=25%  Similarity=0.386  Sum_probs=61.2

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCCCHHHEEEEECCCHHHHHHHHHHHHH
Q ss_conf             72688079997068723789999998752008987999973885566889981988334489725848999999999974
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVR  142 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~~~~~a~~~Gvd~~~l~~~~~~~~E~~~~i~~~li~  142 (363)
T Consensus       201 gi~pPKGvLmYGPPGTGKTlmARAcAaqT~a-----TF-----------LKLAgPQLVQMfIG--dGA-kLVRDAFaLAK  261 (424)
T KOG0652         201 GIRPPKGVLMYGPPGTGKTLMARACAAQTNA-----TF-----------LKLAGPQLVQMFIG--DGA-KLVRDAFALAK  261 (424)
T ss_pred             CCCCCCCEEEECCCCCCHHHHHHHHHHHCCC-----HH-----------HHHCCHHHHHHHHC--CHH-HHHHHHHHHHH
T ss_conf             8889972276579997577999999874010-----68-----------87326477766533--418-89999998753


Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHH-HHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEE-EECC
Q ss_conf             489768998143332202655434-555302247888767767777642017818999-8634
Q gi|255764460|r  143 SGAVDIIVIDSVAALTPRAEIEGD-MGESLPGMQARLMSQALRKLTSSISRSKCILVF-INQM  203 (363)
Q Consensus       143 ~~~~~liViDSi~al~p~~Eie~~-~~d~~~g~~ar~ms~~lrkl~~~~~k~~~~~i~-iNQ~  203 (363)
T Consensus       262 EkaP~IIFIDElDAIGtKR-fDSek~GDR---EVQRTMLELLNQLDGFss~~~vKviAATNRv  320 (424)
T KOG0652         262 EKAPTIIFIDELDAIGTKR-FDSEKAGDR---EVQRTMLELLNQLDGFSSDDRVKVIAATNRV  320 (424)
T ss_pred             CCCCEEEEEECHHHHCCCC-CCCCCCCCH---HHHHHHHHHHHHCCCCCCCCCEEEEEECCCC
T ss_conf             3498389973002323343-653123438---9999999999860489975626788521643