HHsearch alignment for GI: 255764460 and conserved domain: KOG1533

>KOG1533 consensus.
Probab=95.68  E-value=0.016  Score=35.57  Aligned_cols=38  Identities=21%  Similarity=0.215  Sum_probs=26.4

Q ss_pred             EEECCCCHHHHHHHHHHHHHHHCCCE--EEEEECCCCCCH
Q ss_conf             97068723789999998752008987--999973885566
Q gi|255764460|r   72 IYGPESSGKTTLALHTIAQSQKTGGT--CAFVDAEHALDS  109 (363)
Q Consensus        72 i~G~~~sGKTtlal~~~a~~qk~g~~--~~~iD~E~~~~~  109 (363)
T Consensus         7 VIGPPgSGKsTYc~g~~~fls~~gr~~~vVNLDPaNd~~~   46 (290)
T KOG1533           7 VIGPPGSGKSTYCNGMSQFLSAIGRPVAVVNLDPANDNLP   46 (290)
T ss_pred             EECCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCC
T ss_conf             8769999853113209999997489627995687656788