HHsearch alignment for GI: 255764460 and conserved domain: KOG2373

>KOG2373 consensus.
Probab=95.75  E-value=0.04  Score=33.02  Aligned_cols=142  Identities=17%  Similarity=0.203  Sum_probs=74.7

Q ss_pred             CCCHHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCC---------------------
Q ss_conf             77278999723897268807999706872378999999875200898799997388556---------------------
Q gi|255764460|r   50 SGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALD---------------------  108 (363)
Q Consensus        50 TG~~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~~---------------------  108 (363)
T Consensus       258 kRFpvLNk~L--kGhR~GElTvlTGpTGsGKTTFlsEYsLDL~~QGVnTLwgSFEi~n~rla~~mL~Qyagyrl~drl~~  335 (514)
T KOG2373         258 KRFPVLNKYL--KGHRPGELTVLTGPTGSGKTTFLSEYSLDLFTQGVNTLWGSFEIPNKRLAHWMLVQYAGYRLLDRLNS  335 (514)
T ss_pred             HHHHHHHHHH--CCCCCCCEEEEECCCCCCCEEEEHHHHHHHHHHHHHHEEEEEECCHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             0206889985--36787726998568889823675676589986322440650043608999999999716723755545


Q ss_pred             -HHHHHHHCCCHHHE-EEEECCCHHHH----HHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHH
Q ss_conf             -68899819883344-89725848999----9999999744897689981433322026554345553022478887677
Q gi|255764460|r  109 -SIYARKLGVDLKNL-LISQPDTGEQA----LEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQA  182 (363)
Q Consensus       109 -~~~a~~~Gvd~~~l-~~~~~~~~E~~----~~i~~~li~~~~~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~  182 (363)
T Consensus       336 y~HWadrFE----rlplyfmtfhgqq~~~~vi~~i~ha~yV~di~HViIDNLQFmmg~~~~~~---D-rf~~QD~iig-~  406 (514)
T KOG2373         336 YKHWADRFE----RLPLYFMTFHGQQFMEKVINEIAHAIYVEDIQHVIIDNLQFMMGQGMMAL---D-RFHLQDRIIG-Y  406 (514)
T ss_pred             HHHHHHHHH----CCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCC---C-HHHHHHHHHH-H
T ss_conf             667899875----26367610246106888999998999887546444555788746430100---0-4566778999-9


Q ss_pred             HHHHHHHHCCCCCEEEEEECCCC
Q ss_conf             67777642017818999863411
Q gi|255764460|r  183 LRKLTSSISRSKCILVFINQMRM  205 (363)
Q Consensus       183 lrkl~~~~~k~~~~~i~iNQ~r~  205 (363)
T Consensus       407 fR~f---AT~nn~HvTlVvHPRK  426 (514)
T KOG2373         407 FRQF---ATQNNIHVTLVVHPRK  426 (514)
T ss_pred             HHHH---HHCCCEEEEEEECCCC
T ss_conf             9987---5426606999965665