HHsearch alignment for GI: 255764460 and conserved domain: PRK00635

>PRK00635 excinuclease ABC subunit A; Provisional.
Probab=95.61  E-value=0.013  Score=36.17  Aligned_cols=31  Identities=39%  Similarity=0.500  Sum_probs=22.8

Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHH-HHHHC
Q ss_conf             26880799970687237899999987-52008
Q gi|255764460|r   64 FPKGRIVEIYGPESSGKTTLALHTIA-QSQKT   94 (363)
Q Consensus        64 ~p~Gri~ei~G~~~sGKTtlal~~~a-~~qk~   94 (363)
T Consensus        23 IP~~~lvViTGvSGSGKSSLAFDTiyAEgqRr   54 (1809)
T PRK00635         23 FCPREIVLLTGVSGSGKSSLAFDTIYAAGRKR   54 (1809)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
T ss_conf             16998899979988978999989999989889