HHsearch alignment for GI: 255764460 and conserved domain: PRK04328

>PRK04328 hypothetical protein; Provisional.
Probab=99.90  E-value=1.6e-21  Score=155.72  Aligned_cols=209  Identities=19%  Similarity=0.299  Sum_probs=147.4

Q ss_pred             CCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCH--HHHHHHCCCHHH-
Q ss_conf             55014772789997238972688079997068723789999998752008987999973885566--889981988334-
Q gi|255764460|r   45 IEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDS--IYARKLGVDLKN-  121 (363)
Q Consensus        45 ~~~i~TG~~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~~~--~~a~~~Gvd~~~-  121 (363)
T Consensus         3 ~eRv~TGI~gLD~lL~-GGlp~gs~~Lv~G~pGtGKT~la~qFl~~g~~~GE~~lyis~eE~~~~l~~~~~~~G~d~~~~   81 (250)
T PRK04328          3 VKRVKTGIPGMDEILY-GGIPERNVVLLSGGPGTGKSIFSQQFLWNGLQMGEPGIYVALEEHPVQVRRNMAQFGWDVRKY   81 (250)
T ss_pred             CCEECCCCHHHHHHCC-CCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCHHHHHHHHHHCCCCHHHH
T ss_conf             4110358566787515-998799699998289999899999999999876997799997279999999999809986898


Q ss_pred             -----EEEE-------------------ECCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHHH
Q ss_conf             -----4897-------------------2584899999999997448976899814333220265543455530224788
Q gi|255764460|r  122 -----LLIS-------------------QPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQAR  177 (363)
Q Consensus       122 -----l~~~-------------------~~~~~E~~~~i~~~li~~~~~~liViDSi~al~p~~Eie~~~~d~~~g~~ar  177 (363)
T Consensus        82 ~~~g~l~iid~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~rvVIDSit~l~----~~~~-------~~~-  149 (250)
T PRK04328         82 EEEGKFAIVDAFTGGIGEAAEREKYVVKDPDDVRELIDVLRQAIRDIGAKRVVIDSVSTLY----LTKP-------AVA-  149 (250)
T ss_pred             HHCCCEEEEECCCCCCCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCHHHH----HCCH-------HHH-
T ss_conf             6569779985123333420000010136853599999999999985189889993707877----4585-------889-


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEEEEEEEEC
Q ss_conf             87677677776420178189998634114566546651256553111111248975045534457724767999877405
Q gi|255764460|r  178 LMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKDSITGNQTRVKVVKN  257 (363)
Q Consensus       178 ~ms~~lrkl~~~~~k~~~~~i~iNQ~r~~ig~m~g~p~~~~GG~al~~~aS~rl~i~k~~~ik~~~~~iG~~v~~kv~Kn  257 (363)
T Consensus       150 --r~~l~~l~~~l~~~g~Ttll~~e~~~~~~--------~~~~~~ve~~~DgvI~L~~~~~---~~~---~~R~l~I~Km  213 (250)
T PRK04328        150 --RSIVMQLKRVLAGLGCTSIFVSQVSVGER--------GFGGPGVEHAVDGIIRLDLDEI---DGE---LKRSLIVWKM  213 (250)
T ss_pred             --HHHHHHHHHHHHHCCCEEEEEECCCCCCC--------CCCCCCEEEEEEEEEEEEEECC---CCE---EEEEEEEEEC
T ss_conf             --99999999999868986999971003656--------6677865899989999888713---997---9999999988


Q ss_pred             CCCCCCCE-EEEEEECCCCCCCCCHHH
Q ss_conf             77898515-899986187423111599
Q gi|255764460|r  258 KMASPFKQ-VEFDIMYGEGISFFGELI  283 (363)
Q Consensus       258 k~~~P~~~-a~~~i~fg~GI~~~~~ll  283 (363)
T Consensus       214 Rgs~h~~~~~~f~It-~~GI~V~P~~~  239 (250)
T PRK04328        214 RGTKHSMRRHPFEIT-DKGIVVYPDKV  239 (250)
T ss_pred             CCCCCCCCEEEEEEC-CCCEEEECCHH
T ss_conf             699658956999987-99689954413