HHsearch alignment for GI: 255764460 and conserved domain: PRK07721

>PRK07721 fliI flagellum-specific ATP synthase; Validated.
Probab=97.70  E-value=0.0002  Score=47.58  Aligned_cols=112  Identities=21%  Similarity=0.269  Sum_probs=70.9

Q ss_pred             CCCCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCC-HHHHHH-HC---C
Q ss_conf             465501477278999723897268807999706872378999999875200898799997388556-688998-19---8
Q gi|255764460|r   43 EGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALD-SIYARK-LG---V  117 (363)
Q Consensus        43 ~~~~~i~TG~~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~~-~~~a~~-~G---v  117 (363)
T Consensus       135 ~i~e~l~TGIraID~l~t---igkGQRigIf~gsGvGKs~Ll~~iar~~~-adv~V~~liGeR~rEv~efie~~l~~~~l  210 (435)
T PRK07721        135 PIREKMEVGVRAIDSLLT---VGKGQRVGIFAGSGVGKSTLMGMIARQTS-ADLNVIALIGERGREVREFIERDLGEEGL  210 (435)
T ss_pred             CCCCCCCCCCEEECCCCC---CCCCCEEEECCCCCCCHHHHHHHHHHHHC-CCEEEEEEECCCHHHHHHHHHHHHCCCCC
T ss_conf             988630378565226476---03575410026899878999999988744-88258999332028999999975221555


Q ss_pred             CHHHEEEEECCC--------HHHHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             833448972584--------89999999999744897689981433322
Q gi|255764460|r  118 DLKNLLISQPDT--------GEQALEITDMLVRSGAVDIIVIDSVAALT  158 (363)
Q Consensus       118 d~~~l~~~~~~~--------~E~~~~i~~~li~~~~~~liViDSi~al~  158 (363)
T Consensus       211 ~rsvvv~atsd~p~~~R~~a~~~a~tiAEyfrd~G~~VLl~~Dsltr~A  259 (435)
T PRK07721        211 KRSIVVVATSDQPALMRIKGAYTATAIAEYFRDKGQNVMLMMDSVTRVA  259 (435)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHH
T ss_conf             3239999438899999999999988899999967997899516388999