HHsearch alignment for GI: 255764460 and conserved domain: PRK08233

>PRK08233 hypothetical protein; Provisional.
Probab=96.86  E-value=0.011  Score=36.57  Aligned_cols=83  Identities=19%  Similarity=0.164  Sum_probs=49.8

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCC-CCCHHHHHHH---CCCHHHEEEEECCCHHHHHHHHHHHHHC
Q ss_conf             07999706872378999999875200898799997388-5566889981---9883344897258489999999999744
Q gi|255764460|r   68 RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEH-ALDSIYARKL---GVDLKNLLISQPDTGEQALEITDMLVRS  143 (363)
Q Consensus        68 ri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~-~~~~~~a~~~---Gvd~~~l~~~~~~~~E~~~~i~~~li~~  143 (363)
T Consensus         4 ~IIgIaGgSgSGKTtla~~l~~~l~--~~~~~~~D~y~~~~~~~~~~~~~~~~~~~d~-----~d-~~~l~~~l~~l~~~   75 (182)
T PRK08233          4 KIITIAAVSGGGKTTLTERLTHKLK--NSKALYFDRYDFDNCPEDICKWIDDGANYSE-----WV-LTPLIKDIQELIAK   75 (182)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHCC--CCEEEEECCCCCCCCHHHHHHHHCCCCCCCH-----HH-HHHHHHHHHHHHCC
T ss_conf             8999968886789999999999746--7758996665554687889987406778666-----66-99999999998559


Q ss_pred             CCCCEEEEECCCCCC
Q ss_conf             897689981433322
Q gi|255764460|r  144 GAVDIIVIDSVAALT  158 (363)
Q Consensus       144 ~~~~liViDSi~al~  158 (363)
T Consensus        76 ~~~d~iIvEgil~l~   90 (182)
T PRK08233         76 SNVDYIIVDYPFAYL   90 (182)
T ss_pred             CCCCEEEEEEEHHHC
T ss_conf             987289996443626