HHsearch alignment for GI: 255764460 and conserved domain: PRK08939

>PRK08939 primosomal protein DnaI; Reviewed.
Probab=96.88  E-value=0.0071  Score=37.76  Aligned_cols=78  Identities=22%  Similarity=0.367  Sum_probs=52.9

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCCCHHHEEEEECCCHHHHHHHHHHHH
Q ss_conf             97268807999706872378999999875200898799997388556688998198833448972584899999999997
Q gi|255764460|r   62 GGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLV  141 (363)
Q Consensus        62 GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~~~~~a~~~Gvd~~~l~~~~~~~~E~~~~i~~~li  141 (363)
T Consensus       154 ~~~~kG-l-yl~G~~G~GKTyL~~aian~La~~g~~v~~v~-----~p~~~~~lK----~s~--~d~s~~~~i~---~~-  216 (306)
T PRK08939        154 GEKVKG-L-YLYGDFGVGKTYLLAAIANELAKKGVSSTLVH-----FPEFIRELK----NAI--SDGSVKEKID---AV-  216 (306)
T ss_pred             CCCCCE-E-EEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE-----HHHHHHHHH----HHH--CCCCHHHHHH---HH-
T ss_conf             988877-8-89899999899999999999998699299987-----599999999----986--4898899999---98-


Q ss_pred             HCCCCCEEEEECCCCCC
Q ss_conf             44897689981433322
Q gi|255764460|r  142 RSGAVDIIVIDSVAALT  158 (363)
Q Consensus       142 ~~~~~~liViDSi~al~  158 (363)
T Consensus       217 k--~~~vLiLDDiGaE~  231 (306)
T PRK08939        217 K--EAPVLMLDDIGAEQ  231 (306)
T ss_pred             H--CCCEEEEECCCCCC
T ss_conf             4--49989984446542