HHsearch alignment for GI: 255764460 and conserved domain: PRK09165

>PRK09165 replicative DNA helicase; Provisional.
Probab=99.58  E-value=2.4e-12  Score=97.67  Aligned_cols=226  Identities=17%  Similarity=0.262  Sum_probs=137.2

Q ss_pred             CCCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHH---------------CCCEEEEEECCCCCC
Q ss_conf             65501477278999723897268807999706872378999999875200---------------898799997388556
Q gi|255764460|r   44 GIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQK---------------TGGTCAFVDAEHALD  108 (363)
Q Consensus        44 ~~~~i~TG~~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk---------------~g~~~~~iD~E~~~~  108 (363)
T Consensus       184 ~~~Gi~TGf~~LD~~t--~G~~~GdLiIIAARPsmGKTafaLniA~n~A~~~~~~~~~~~~~~~~~g~~V~~FSLEMs~~  261 (484)
T PRK09165        184 HLSGISTGLRDLDSKL--GGLHPSDLIILAGRPSMGKTALATNIAFNAAKAYLREAQPDGSKKAVNGGVVGFFSLEMSAE  261 (484)
T ss_pred             CCCCEECCCHHHHHHH--CCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCCCHH
T ss_conf             9773315844599871--58887737999607999778999999999998741022223321136898489994779999


Q ss_pred             HH----HHHHHCCCHHHE-------------------------EEEE-C-CCHHHHHHHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             68----899819883344-------------------------8972-5-848999999999974489768998143332
Q gi|255764460|r  109 SI----YARKLGVDLKNL-------------------------LISQ-P-DTGEQALEITDMLVRSGAVDIIVIDSVAAL  157 (363)
Q Consensus       109 ~~----~a~~~Gvd~~~l-------------------------~~~~-~-~~~E~~~~i~~~li~~~~~~liViDSi~al  157 (363)
T Consensus       262 ql~~Rlls~~s~V~~~~ir~g~l~~~e~~~i~~a~~~l~~~~l~IdD~~~~ti~~Ira~~Rr~k~~~gl~livIDYLqLi  341 (484)
T PRK09165        262 QLATRILSEQSEISSSKIRRGKISEEDFEKLVDASQELQKLPLYIDDTPALSISALRARARRLKRQHGLDLLVIDYLQLI  341 (484)
T ss_pred             HHHHHHHHHHHCCCHHHHHCCCCCHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEECHHHC
T ss_conf             99999999972686135544899999999999999999719848977999879999999999998609988999517635


Q ss_pred             CCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCC-CCCCCC--CCCCCCCCCCEEEEEE
Q ss_conf             2026554345553022478887677677776420178189998634114566546-651256--5531111112489750
Q gi|255764460|r  158 TPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFG-SPETTT--GGNALKFYSSVRLDIR  234 (363)
Q Consensus       158 ~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k~~~~~i~iNQ~r~~ig~m~g-~p~~~~--GG~al~~~aS~rl~i~  234 (363)
T Consensus       342 ~~~~~~~~---~----~R~~ev~~Isr~LK~lAkel~ipVi~LsQLnR~~E~R~dkrP~lsDLReSGsIEQDADvV~fly  414 (484)
T PRK09165        342 RGSSKRSQ---D----NRVQEISEITQGLKALAKELNIPVIALSQLSRQVEQRDDKRPQLSDLRESGSIEQDADVVMFVY  414 (484)
T ss_pred             CCCCCCCC---H----HHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCEEEEEC
T ss_conf             78888861---2----1999999999999999999699699974578442347999976001035552022077899964


Q ss_pred             CCCCC------CCC----------CEEEEEEEEEEEEECCCCCCCCEEEEEEECCCCCCCCCH
Q ss_conf             45534------457----------724767999877405778985158999861874231115
Q gi|255764460|r  235 RVGSI------KDK----------DSITGNQTRVKVVKNKMASPFKQVEFDIMYGEGISFFGE  281 (363)
Q Consensus       235 k~~~i------k~~----------~~~iG~~v~~kv~Knk~~~P~~~a~~~i~fg~GI~~~~~  281 (363)
T Consensus       415 R~~yY~~~~~~~~~~~~~~~~~~~~~~~~~~~elivaKnRnG~~---G~v~l~f~~~~~rF~d  474 (484)
T PRK09165        415 REEYYLKRKEPREGTPKHEEWQEKMEKVHNKAEVIIAKQRHGPT---GTVKLHFESEFTRFGD  474 (484)
T ss_pred             CHHHHCCCCCCCCCCCCHHHHHHHCCCCCCCEEEEEECCCCCCC---EEEEEEEECCCCCCCC
T ss_conf             47661344587767520122321012458807999963788986---0699998778776227