HHsearch alignment for GI: 255764460 and conserved domain: PRK09493

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed.
Probab=97.04  E-value=0.014  Score=35.82  Aligned_cols=41  Identities=32%  Similarity=0.464  Sum_probs=29.3

Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             268807999706872378999999875200898799997388
Q gi|255764460|r   64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEH  105 (363)
Q Consensus        64 ~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~  105 (363)
T Consensus        24 i~~Ge~~~liG~nGsGKSTll-~~i~Gl~~~~~G~i~~~G~~   64 (240)
T PRK09493         24 IDQGEVVVIIGPSGSGKSTLL-RCINKLEEITSGDLIVDGLK   64 (240)
T ss_pred             ECCCCEEEEECCCCCHHHHHH-HHHHCCCCCCCCEEEECCEE
T ss_conf             879989999999998099999-99963899999748789998