HHsearch alignment for GI: 255764460 and conserved domain: PRK10261

>PRK10261 glutathione transporter ATP-binding protein; Provisional.
Probab=97.30  E-value=0.0051  Score=38.66  Aligned_cols=55  Identities=16%  Similarity=0.210  Sum_probs=25.7

Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             9999999997448976899814333220265543455530224788876776777764201781899986341
Q gi|255764460|r  132 QALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMR  204 (363)
Q Consensus       132 ~~~~i~~~li~~~~~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k~~~~~i~iNQ~r  204 (363)
T Consensus       175 QRV~IA~ALa~--~P~lLIlDEPTs-----~LD~-------~~~~~i----l~ll~~L~~e~g~tvl~ItHdl  229 (623)
T PRK10261        175 QRVMIAMALSC--RPAVLIADEPTT-----ALDV-------TIQAQI----LQLIKVLQKEMSMGVIFITHDM  229 (623)
T ss_pred             HHHHHHHHHHC--CCCEEEECCCCC-----CCCH-------HHHHHH----HHHHHHHHHHHCCCCEEECCCH
T ss_conf             99999998741--886588557743-----4368-------999999----9999999887523520553778