HHsearch alignment for GI: 255764460 and conserved domain: PRK11153

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional.
Probab=96.70  E-value=0.029  Score=33.90  Aligned_cols=42  Identities=24%  Similarity=0.461  Sum_probs=30.3

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             7268807999706872378999999875200898799997388
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEH  105 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~  105 (363)
T Consensus        27 ~I~~Gei~giIG~SGaGKSTLl-r~i~gL~~ptsG~I~~~G~d   68 (343)
T PRK11153         27 HVPAGQIYGVIGASGAGKSTLI-RCVNLLERPTSGSVIVDGQD   68 (343)
T ss_pred             EECCCCEEEEECCCCCHHHHHH-HHHHCCCCCCCEEEEECCEE
T ss_conf             9989989999999998699999-99965999996399999999