HHsearch alignment for GI: 255764460 and conserved domain: PRK11308

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional.
Probab=97.76  E-value=0.00067  Score=44.24  Aligned_cols=42  Identities=24%  Similarity=0.451  Sum_probs=28.6

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             7268807999706872378999999875200898799997388
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEH  105 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~  105 (363)
T Consensus        37 ~i~~GE~lgiVGeSGsGKSTL~~~l~gl~~p~~G~I-~~~G~d   78 (327)
T PRK11308         37 NLERGKTLAVVGESGCGKSTLARLLTMIETPTGGEL-YYQGQD   78 (327)
T ss_pred             EECCCCEEEEECCCCHHHHHHHHHHHCCCCCCCCEE-EECCEE
T ss_conf             988999999999983199999999956999886379-989995