HHsearch alignment for GI: 255764460 and conserved domain: PRK11614

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional.
Probab=96.93  E-value=0.016  Score=35.57  Aligned_cols=42  Identities=29%  Similarity=0.434  Sum_probs=29.3

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             7268807999706872378999999875200898799997388
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEH  105 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~  105 (363)
T Consensus        27 ~i~~Gei~~liG~NGaGKSTLl~~i~G~~~~~~G~I-~~~G~~   68 (237)
T PRK11614         27 HINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRI-VFDGKD   68 (237)
T ss_pred             EECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEE-EECCEE
T ss_conf             986997999987999759999999967998896289-999998