HHsearch alignment for GI: 255764460 and conserved domain: PRK11629

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional.
Probab=97.46  E-value=0.0036  Score=39.64  Aligned_cols=41  Identities=22%  Similarity=0.392  Sum_probs=30.4

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             726880799970687237899999987520089879999738
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE  104 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E  104 (363)
T Consensus        31 ~i~~GE~v~iiG~sGsGKSTLl-~~i~Gl~~p~~G~I~~~g~   71 (233)
T PRK11629         31 SIGEGEMMAIVGSSGSGKSTLL-HLLGGLDTPTSGDVIFNGQ   71 (233)
T ss_pred             EECCCCEEEEECCCCCCHHHHH-HHHHCCCCCCCEEEEECCE
T ss_conf             9889989999999994099999-9996699998639999999