HHsearch alignment for GI: 255764460 and conserved domain: PRK12377

>PRK12377 putative replication protein; Provisional.
Probab=97.90  E-value=8.4e-05  Score=49.93  Aligned_cols=117  Identities=15%  Similarity=0.215  Sum_probs=73.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCCCHHHEEEEECCCHHHHHHHHHHHHHCCCC
Q ss_conf             80799970687237899999987520089879999738855668899819883344897258489999999999744897
Q gi|255764460|r   67 GRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLGVDLKNLLISQPDTGEQALEITDMLVRSGAV  146 (363)
Q Consensus        67 Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~~~~~a~~~Gvd~~~l~~~~~~~~E~~~~i~~~li~~~~~  146 (363)
T Consensus       101 ~~NlIf~G~pGtGKTHLA~AIg~~a~~~G~sVlF~t~~dLv~~L~~a~-----~~-----g~~~~k---~l~~l~---~~  164 (248)
T PRK12377        101 CTNFVFSGKPGTGKNHLAAAIGNRLLAKGRSVIVVTVPDVMSRLHESY-----DN-----GQSGEK---FLQELC---KV  164 (248)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHHHHHHHHHH-----HC-----CCCHHH---HHHHHH---CC
T ss_conf             860899899998788999999999998799699988999999999999-----84-----850999---999973---38


Q ss_pred             CEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCC
Q ss_conf             68998143332202655434555302247888767767777642017818999863411456654665
Q gi|255764460|r  147 DIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMFGSP  214 (363)
Q Consensus       147 ~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k~~~~~i~iNQ~r~~ig~m~g~p  214 (363)
T Consensus       165 dLLIIDElG~~-~~s~~~-----------~---~llfqlI~~Ry~~~ks~IiTTNL~f~ew~~ilgda  217 (248)
T PRK12377        165 DLLVLDEIGIQ-RETKNE-----------Q---VVLNQIIDRRTASMRSVGMLTNLNHEAMSTLLGER  217 (248)
T ss_pred             CEEEEHHCCCC-CCCHHH-----------H---HHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHH
T ss_conf             98986000578-898679-----------9---99999999998557986897589977998887599