HHsearch alignment for GI: 255764460 and conserved domain: PRK13539

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional.
Probab=96.71  E-value=0.041  Score=32.94  Aligned_cols=39  Identities=31%  Similarity=0.381  Sum_probs=28.6

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCC-CEEEEE
Q ss_conf             9726880799970687237899999987520089-879999
Q gi|255764460|r   62 GGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTG-GTCAFV  101 (363)
Q Consensus        62 GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g-~~~~~i  101 (363)
T Consensus        23 f~i~~Gei~~l~G~NGaGKTTLl-k~i~Gl~~p~~G~I~~~   62 (206)
T PRK13539         23 FTLAAGEALVLTGPNGSGKTTLL-RLLAGLLPPAAGTIKLD   62 (206)
T ss_pred             EEECCCCEEEEECCCCCCHHHHH-HHHHCCCCCCCEEEEEC
T ss_conf             89869949999899999899999-99958878885189999