HHsearch alignment for GI: 255764460 and conserved domain: PRK13542

>PRK13542 consensus.
Probab=97.02  E-value=0.014  Score=35.95  Aligned_cols=54  Identities=24%  Similarity=0.358  Sum_probs=33.9

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECC--CCCCHHHHHHHC
Q ss_conf             9726880799970687237899999987520089879999738--855668899819
Q gi|255764460|r   62 GGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE--HALDSIYARKLG  116 (363)
Q Consensus        62 GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E--~~~~~~~a~~~G  116 (363)
T Consensus        39 l~i~~Gei~~liGpNGaGKTTLlk~l~Gll~p~~G~I~~-~G~~i~~~~~~~~~~~~   94 (224)
T PRK13542         39 ISLAPGDLLQVMGPNGSGKTSLLRVLSGLMPPAEGDLYW-RGRAVRAGDPDYLQQLA   94 (224)
T ss_pred             EEECCCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEE-CCEECCCCCHHHHHHEE
T ss_conf             787599799999999999999999995797888528999-99999879988884447