HHsearch alignment for GI: 255764460 and conserved domain: PRK13634

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=97.24  E-value=0.0094  Score=37.00  Aligned_cols=38  Identities=37%  Similarity=0.494  Sum_probs=27.1

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             72688079997068723789999998752008987999
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAF  100 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~  100 (363)
T Consensus        16 ~i~~Ge~vaiiG~sGsGKSTLl~~l~GLl~P~~G~i~~   53 (276)
T PRK13634         16 SIPSGSYVAIIGHTGSGKSTLLQHLNGLLKPTKGTVTI   53 (276)
T ss_pred             EECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEEE
T ss_conf             99899899999999969999999997499988749999