HHsearch alignment for GI: 255764460 and conserved domain: PRK13636

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=97.56  E-value=0.0026  Score=40.52  Aligned_cols=51  Identities=24%  Similarity=0.337  Sum_probs=34.2

Q ss_pred             CCHHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             727899972389726880799970687237899999987520089879999738
Q gi|255764460|r   51 GSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE  104 (363)
Q Consensus        51 G~~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E  104 (363)
T Consensus        18 g~~aL~~i-s-l~I~~Ge~~aiiG~NGaGKSTLl~~i~Gll~p~~G~I-~~~G~   68 (285)
T PRK13636         18 GTHALKGI-N-INIKKGEVTAILGGNGAGKSTLFQNLNGILKPSSGRI-LFDGK   68 (285)
T ss_pred             CCEEEEEE-E-EEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEE-EECCE
T ss_conf             98887613-7-8987998999999999809999999965988886089-99999