HHsearch alignment for GI: 255764460 and conserved domain: PRK13641

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=97.18  E-value=0.01  Score=36.75  Aligned_cols=41  Identities=27%  Similarity=0.340  Sum_probs=29.5

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             972688079997068723789999998752008987999973
Q gi|255764460|r   62 GGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDA  103 (363)
Q Consensus        62 GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~  103 (363)
T Consensus        28 l~I~~Ge~~~iiG~nGsGKSTLl~~l~Gll~P~sG~V-~i~G   68 (286)
T PRK13641         28 FELEDGSFVALIGHTGSGKSTLMQHFNALLKPSSGKI-TIAG   68 (286)
T ss_pred             EEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEE-EECC
T ss_conf             7986999999999998399999999965989885499-9998