HHsearch alignment for GI: 255764460 and conserved domain: PRK13642

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=97.36  E-value=0.0025  Score=40.59  Aligned_cols=41  Identities=32%  Similarity=0.358  Sum_probs=30.8

Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             268807999706872378999999875200898799997388
Q gi|255764460|r   64 FPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEH  105 (363)
Q Consensus        64 ~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~  105 (363)
T Consensus        30 i~~Ge~~aiiG~sGsGKSTL~~~l~Gl~~~~~G~I-~~~G~~   70 (277)
T PRK13642         30 ITKGEWVSIIGQNGSGKSTTARLIDGLFEEFEGIV-KIDGER   70 (277)
T ss_pred             ECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEE-EECCEE
T ss_conf             88998999999999689999999963899888489-999999