HHsearch alignment for GI: 255764460 and conserved domain: PRK13721

>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional.
Probab=95.99  E-value=0.017  Score=35.31  Aligned_cols=50  Identities=20%  Similarity=0.316  Sum_probs=43.0

Q ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHC
Q ss_conf             880799970687237899999987520089879999738855668899819
Q gi|255764460|r   66 KGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSIYARKLG  116 (363)
Q Consensus        66 ~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~~~~~a~~~G  116 (363)
T Consensus       473 tN~N~~I~g~SGsGKSf~~q~l~~~~~~~G~~V~IID~G~SY-~~lc~~~g  522 (864)
T PRK13721        473 TNYNMAVCGTSGAGKTGLIQPLIRSVLDSGGFAVVFDMGDGY-KSLCENMG  522 (864)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCH-HHHHHHCC
T ss_conf             870069982899868999999999998579979999699789-99999739