HHsearch alignment for GI: 255764460 and conserved domain: PTZ00185

>PTZ00185 ATPase alpha subunit; Provisional.
Probab=95.78  E-value=0.12  Score=30.00  Aligned_cols=160  Identities=20%  Similarity=0.303  Sum_probs=89.0

Q ss_pred             CCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHH--------HCCCEEEEEECCCCCCH-----HHH
Q ss_conf             50147727899972389726880799970687237899999987520--------08987999973885566-----889
Q gi|255764460|r   46 EVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQ--------KTGGTCAFVDAEHALDS-----IYA  112 (363)
Q Consensus        46 ~~i~TG~~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~q--------k~g~~~~~iD~E~~~~~-----~~a  112 (363)
T Consensus       171 ePl~TGikaIDamIPIG---RGQRELIIGDRQTGKTaIAiDTIINQk~~n~~~~k~~~V~CIYVAIGQK~StVA~iv~~L  247 (574)
T PTZ00185        171 YNLLTGFKAVDTMIPIG---RGQRELIVGDRQTGKTSIAVSTIINQVRINQQILSKNAVISIYVSIGQRCSNVARIHRLL  247 (574)
T ss_pred             CHHHHHHHHHHHCCCCC---CCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHH
T ss_conf             45565567886436667---885203555776556899999998376434465778966999998541289999999999


Q ss_pred             HHHCCCHHH-EEEEEC--CCH-HHH------HHHHHHHHHCCCCCEEEEECCCCCCC-HHHH----HHHHH-HHCCC---
Q ss_conf             981988334-489725--848-999------99999997448976899814333220-2655----43455-53022---
Q gi|255764460|r  113 RKLGVDLKN-LLISQP--DTG-EQA------LEITDMLVRSGAVDIIVIDSVAALTP-RAEI----EGDMG-ESLPG---  173 (363)
Q Consensus       113 ~~~Gvd~~~-l~~~~~--~~~-E~~------~~i~~~li~~~~~~liViDSi~al~p-~~Ei----e~~~~-d~~~g---  173 (363)
T Consensus       248 ~e~gA-m~yTiIVaAtAsd~a~lQYLAPYaG~AmaEyFm~~G~dvLIVyDDLSKhA~AYRqmSLLLRRPPGREAYPGDVF  326 (574)
T PTZ00185        248 RSYGA-LRYTTVMAATAAEPAGLQYLAPYSGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVF  326 (574)
T ss_pred             HHCCC-CCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHCCCCCCCCCCCCCCEE
T ss_conf             97697-20308999247775144232110125777898856984799965807889999998720689999879887661


Q ss_pred             -HHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCC
Q ss_conf             -478887677677776420178189998634114566
Q gi|255764460|r  174 -MQARLMSQALRKLTSSISRSKCILVFINQMRMKIGV  209 (363)
Q Consensus       174 -~~ar~ms~~lrkl~~~~~k~~~~~i~iNQ~r~~ig~  209 (363)
T Consensus       327 YlHSRLLERAaKls~~~GgGSiTALPIIETqaGDvSA  363 (574)
T PTZ00185        327 YLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTA  363 (574)
T ss_pred             EECHHHHHHHHHCCCCCCCEEEEECEEEEECCCCEEE
T ss_conf             1101788888752445698004642069960785510