HHsearch alignment for GI: 255764460 and conserved domain: TIGR00665

>TIGR00665 DnaB replicative DNA helicase; InterPro: IPR007692 This family includes the replicative DNA helicases, helicase DnaB, which exhibit DNA-dependent ATPase activity. Helicase DnaB is a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of more than 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. Replication protein, GP12 from Bacteriophage P22 also belongs to this family .; GO: 0003677 DNA binding, 0003678 DNA helicase activity, 0005524 ATP binding, 0006260 DNA replication.
Probab=96.55  E-value=0.0085  Score=37.25  Aligned_cols=239  Identities=18%  Similarity=0.262  Sum_probs=134.2

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             99999999998676188737970366553346550147727899972389726880799970687237899999987520
Q gi|255764460|r   13 SKALEAALSQIQRVYGKGAIMQLGSQGSIFEGIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQ   92 (363)
Q Consensus        13 ~~~l~~~~~~i~k~~g~~~~~~lg~~~~~~~~~~~i~TG~~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~q   92 (363)
T Consensus       173 ~~~~~~~~~~~~~~~~~~----------~~~~~~G~~~gf~~ld~~~--~G~~~~~l~~~~arP~~Gkt~~~~n~~~~~~  240 (465)
T TIGR00665       173 KEVLESTEDLIDKLYRKE----------NHLGVTGIPTGFYDLDKLT--GGFQPGDLIIVAARPSMGKTAFALNIAANAA  240 (465)
T ss_pred             HHHHHHHHHHHHHHHHCC----------CCCCCCCCCCCCHHHHHHH--CCCCCCCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             899999998888874023----------3222566653201344543--2677565588833787525889999998776


Q ss_pred             H------CCCEEEEEECCCCCCHHHHHHH----CCC------------------------HH-H-EEEEE-C-CCHHHHH
Q ss_conf             0------8987999973885566889981----988------------------------33-4-48972-5-8489999
Q gi|255764460|r   93 K------TGGTCAFVDAEHALDSIYARKL----GVD------------------------LK-N-LLISQ-P-DTGEQAL  134 (363)
Q Consensus        93 k------~g~~~~~iD~E~~~~~~~a~~~----Gvd------------------------~~-~-l~~~~-~-~~~E~~~  134 (363)
T Consensus       241 ~~~~~~~~~~~~~~fsle~~~~~~~~r~~~~~~~~~~~~~~~g~l~~~~~~~l~~~~~~~~~~~~~~~~d~~~~~~~~~~  320 (465)
T TIGR00665       241 NREKFDKEDKPVLFFSLEMSAEQLALRLLASESRIDSTKLRTGRLDDEEWEKLTKAMGELSDKLPLYIDDTSGITLTEIR  320 (465)
T ss_pred             HHHHCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCEEECCCCCCHHHHH
T ss_conf             43202423350378851467799999998765310134432003237788889999887530156224205775299999


Q ss_pred             HHHHHHHHCC-C-CCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCC-
Q ss_conf             9999997448-9-768998143332202655434555302247888767767777642017818999863411456654-
Q gi|255764460|r  135 EITDMLVRSG-A-VDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMRMKIGVMF-  211 (363)
Q Consensus       135 ~i~~~li~~~-~-~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k~~~~~i~iNQ~r~~ig~m~-  211 (363)
T Consensus       321 ~~~~~~~~~~~gp~~~~~~dyl~l~~~~~~~---~~~---~r~-~~~~~i~~~lk~~a~e~~~P~~al~~l~r~~e~r~d  393 (465)
T TIGR00665       321 SQARRLKRESGGPLGLILIDYLQLISGSKNS---YGD---NRH-QEVAEISRSLKALARELNVPVIALSQLSRSLEERKD  393 (465)
T ss_pred             HHHHHHHHHCCCCCEEHHHHHHHHHHCCCCC---CCC---CHH-HHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCC
T ss_conf             9999988641785010123457774100023---564---046-889999899998887741416656665322320134


Q ss_pred             CCCCCC--CCCCCCCCCCCEEEEEECCCCCCCCCE-EEE----EEEEEEEEECCCCCCCCEEEEEEECC
Q ss_conf             665125--655311111124897504553445772-476----79998774057789851589998618
Q gi|255764460|r  212 GSPETT--TGGNALKFYSSVRLDIRRVGSIKDKDS-ITG----NQTRVKVVKNKMASPFKQVEFDIMYG  273 (363)
Q Consensus       212 g~p~~~--~GG~al~~~aS~rl~i~k~~~ik~~~~-~iG----~~v~~kv~Knk~~~P~~~a~~~i~fg  273 (363)
T Consensus       394 ~rP~~~dlresG~~e~dad~~~~~~r~~~~~~~~~~~~~~~~~~~~e~~~~k~rnGp~G~---~~~~f~  459 (465)
T TIGR00665       394 KRPILSDLRESGSIEQDADLVLFLYRDEDYDKESEDKGGPKNLFEAELIIAKNRNGPTGT---VKLLFN  459 (465)
T ss_pred             CCCCHHHHHHCCCCCCCCCEEEEEHHCCCCCCCCCCCCCCCHHEEEEEEEEECCCCCCCE---EEEEEC
T ss_conf             563123333216753221012110001003654311245520000000000036787414---887544