HHsearch alignment for GI: 255764460 and conserved domain: TIGR00750

>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components. In Escherichia coli K-12, the arginine-ornithine transport system requires an arginine-ornithine-binding protein and the lysine-arginine-ornithine (LAO) transport system includes a LAO-binding protein. Both periplasmic proteins can be phosphorylated by a single kinase, ArgK resulting in reduced levels of transport activity of the periplasmic transport systems that include each of the binding proteins. The ArgK protein acts as an ATPase enzyme and as a kinase..
Probab=96.27  E-value=0.049  Score=32.46  Aligned_cols=106  Identities=23%  Similarity=0.381  Sum_probs=65.2

Q ss_pred             HHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECC--CCCC-------HHHHHHHC------CC
Q ss_conf             899972389726880799970687237899999987520089879999738--8556-------68899819------88
Q gi|255764460|r   54 GLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE--HALD-------SIYARKLG------VD  118 (363)
Q Consensus        54 ~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E--~~~~-------~~~a~~~G------vd  118 (363)
T Consensus        27 ll~~i~p~~G--nA~~vG~TG~PGaGKSTl~~~l~~~lrRrG~~VaViAvDP~SPfTGGsiLGDr~Rm~~~asrkqlW~d  104 (333)
T TIGR00750        27 LLERILPKTG--NAHVVGITGVPGAGKSTLVEKLIMELRRRGLKVAVIAVDPSSPFTGGSILGDRLRMQRLASRKQLWTD  104 (333)
T ss_pred             HHHHHHHHCC--CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9998624327--90787664688885777999998999765976899988797597551454568877544222233228


Q ss_pred             HHHEEEEECCCHHH------HHHHHHHHHHCCCCCEEEEECCCCCCCHHHHH
Q ss_conf             33448972584899------99999999744897689981433322026554
Q gi|255764460|r  119 LKNLLISQPDTGEQ------ALEITDMLVRSGAVDIIVIDSVAALTPRAEIE  164 (363)
Q Consensus       119 ~~~l~~~~~~~~E~------~~~i~~~li~~~~~~liViDSi~al~p~~Eie  164 (363)
T Consensus       105 Pg~FIRs~ptrG~lGGls~at~~~~-~lldA~G~DVI~vETVGVG--QSEVd  153 (333)
T TIGR00750       105 PGVFIRSMPTRGSLGGLSKATRELV-KLLDAAGYDVILVETVGVG--QSEVD  153 (333)
T ss_pred             CCCEECCCCCCCCHHHHHHHHHHHH-HHHHHCCCCEEEEEEECCC--HHHHH
T ss_conf             9856767766675257879999999-9998638987999841575--24878