HHsearch alignment for GI: 255764460 and conserved domain: TIGR01026

>TIGR01026 fliI_yscN ATPase FliI/YscN family; InterPro: IPR005714 Proteins in this entry show extensive homology to the ATP synthase F1 beta subunit, and are involved in type III protein secretion. They fall into the two separate functional groups outlined below. The first group, exemplified by the Salmonella typhimurium FliI protein (P26465 from SWISSPROT), is needed for flagellar assembly. Most structural components of the bacterial flagellum are translocated through the central channel of the growing flagellar structure by the type III flagellar protein-export apparatus in an ATPase-driven manner, to be assembled at the growing end. FliI is the ATPase that couples ATP hydrolysis to the translocation reaction , . The second group couples ATP hydrolysis to protein translocation in non-flagellar type III secretion systems. Often these systems are involved in virulence and pathogenicity. YscN (P40290 from SWISSPROT) from pathogenic Yersinia species, for example, energises the injection of antihost factors directly into eukaryotic cells, thus overcoming host defences .; GO: 0016887 ATPase activity, 0009058 biosynthetic process, 0015031 protein transport, 0005737 cytoplasm.
Probab=97.18  E-value=0.0012  Score=42.55  Aligned_cols=161  Identities=24%  Similarity=0.336  Sum_probs=101.8

Q ss_pred             CCCCC-CCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCC-CHHHHH-HHCCC
Q ss_conf             34655-0147727899972389726880799970687237899999987520089879999738855-668899-81988
Q gi|255764460|r   42 FEGIE-VVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHAL-DSIYAR-KLGVD  118 (363)
Q Consensus        42 ~~~~~-~i~TG~~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~-~~~~a~-~~Gvd  118 (363)
T Consensus       150 R~~i~~~~~tGVR~iD~LLTvG---kGQR~GIFAGSGVGKStLlGMIARn~~~ADv~ViALIGERGREV~EFIE~~LG~E  226 (455)
T TIGR01026       150 REPIREILSTGVRSIDGLLTVG---KGQRIGIFAGSGVGKSTLLGMIARNNTEADVNVIALIGERGREVKEFIEKDLGEE  226 (455)
T ss_pred             CCCCHHHEECCCEEECCCCCCC---CCCCEEEEECCCCCHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHCCCC
T ss_conf             6300021003645310103555---6650135503760034456676300678982799864377774157886313656


Q ss_pred             -HHH--EEEEECCC--------HHHHHHHHHHHHHCCCCCEEEEECCC--CCCCHHHHHHHHHHH--CCCHHHHHHHHHH
Q ss_conf             -334--48972584--------89999999999744897689981433--322026554345553--0224788876776
Q gi|255764460|r  119 -LKN--LLISQPDT--------GEQALEITDMLVRSGAVDIIVIDSVA--ALTPRAEIEGDMGES--LPGMQARLMSQAL  183 (363)
Q Consensus       119 -~~~--l~~~~~~~--------~E~~~~i~~~li~~~~~~liViDSi~--al~p~~Eie~~~~d~--~~g~~ar~ms~~l  183 (363)
T Consensus       227 GLkrSV~VVaTSD~SPl~R~~GAy~At~iAEYFrdqGk~VlLlmDSvTRfA~A-qREiGLA~GEPP~~kGYt----PSVF  301 (455)
T TIGR01026       227 GLKRSVVVVATSDQSPLLRLKGAYVATAIAEYFRDQGKDVLLLMDSVTRFAMA-QREIGLAAGEPPATKGYT----PSVF  301 (455)
T ss_pred             CCCEEEEEEECCCCCHHHHHHHHHEEHHHHHHHHHCCCEEEEEHHHHHHHHHH-HHHHHHHCCCCCCCCCCC----CCHH
T ss_conf             66011799836886388887326400254354652187056202027899889-889987437777777778----5488


Q ss_pred             HHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             777764201781899986341145665466512565531111112
Q gi|255764460|r  184 RKLTSSISRSKCILVFINQMRMKIGVMFGSPETTTGGNALKFYSS  228 (363)
Q Consensus       184 rkl~~~~~k~~~~~i~iNQ~r~~ig~m~g~p~~~~GG~al~~~aS  228 (363)
T Consensus       302 ~~LP~LlERaG~G-------------~~-----~~GGSITAFYTV  328 (455)
T TIGR01026       302 SLLPRLLERAGKG-------------AS-----GKGGSITAFYTV  328 (455)
T ss_pred             HHHHHHHHHHCCC-------------CC-----CCCCEEEEEEEE
T ss_conf             9989999760687-------------35-----779579888888