HHsearch alignment for GI: 255764460 and conserved domain: TIGR01968

>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223 This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum. In Escherichia coli, the cell division site is determined by the cooperative activity of min operon products MinC, MinD, and MinE . MinD is a membrane-associated ATPase and is a septum site-determining factor through the activation and regulation of MinC and MinE. MinD is also known to undergo a rapid pole-to-pole oscillation movement in vivo as observed by fluorescent microscopy. In plants, chloroplast division requires the dimerisation of stromal MinD . The homologous archaeal MinD proteins, with many archaeal genomes having two or more forms, are described by a separate model.; GO: 0016887 ATPase activity, 0000918 selection of site for barrier septum formation.
Probab=96.17  E-value=0.027  Score=34.05  Aligned_cols=144  Identities=26%  Similarity=0.367  Sum_probs=86.2

Q ss_pred             EEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCH-HHH---HHH----CCC-----------------HHHEEE--
Q ss_conf             97068723789999998752008987999973885566-889---981----988-----------------334489--
Q gi|255764460|r   72 IYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDS-IYA---RKL----GVD-----------------LKNLLI--  124 (363)
Q Consensus        72 i~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~~~-~~a---~~~----Gvd-----------------~~~l~~--  124 (363)
T Consensus         7 TSGKGGVGKTTtTANlG~aLA~lG~kVvliD~DiGLRNLD~~lGLEnRivYt~vDVveG~C~l~qALikDKr~~NL~LLp   86 (272)
T TIGR01968         7 TSGKGGVGKTTTTANLGTALARLGKKVVLIDADIGLRNLDLLLGLENRIVYTLVDVVEGECRLQQALIKDKRLENLYLLP   86 (272)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             81788977358989999999961982899954757034577742310354535543248421100100126752356636


Q ss_pred             -EECC-----CHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             -7258-----4899999999997448976899814333220265543455530224788876776777764201781899
Q gi|255764460|r  125 -SQPD-----TGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILV  198 (363)
Q Consensus       125 -~~~~-----~~E~~~~i~~~li~~~~~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k~~~~~i  198 (363)
T Consensus        87 AsQ~rdK~~~~~E~~~~lv~~Lk~~~~FDYviIDcPA------GIE~GF~nA-------------------v~~Ad~AiV  141 (272)
T TIGR01968        87 ASQTRDKDAVTPEQMKKLVNELKEEEHFDYVIIDCPA------GIESGFRNA-------------------VAPADEAIV  141 (272)
T ss_pred             HHHCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCC------CHHHHHHHH-------------------HHHCCEEEE
T ss_conf             5302361346977899999998543793079973787------743568998-------------------752683589


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCC--EEEEEEEEEEEEECCCCCC
Q ss_conf             986341145665466512565531111112489750455344577--2476799987740577898
Q gi|255764460|r  199 FINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGSIKDKD--SITGNQTRVKVVKNKMASP  262 (363)
Q Consensus       199 ~iNQ~r~~ig~m~g~p~~~~GG~al~~~aS~rl~i~k~~~ik~~~--~~iG~~v~~kv~Knk~~~P  262 (363)
T Consensus       142 Vt------------tPEvs----------avRDADRvIGlLea~~~i~~~GEE~~~~LivNR~rP~  185 (272)
T TIGR01968       142 VT------------TPEVS----------AVRDADRVIGLLEAKGNIEEKGEEVKIKLIVNRLRPE  185 (272)
T ss_pred             EE------------CCCCC----------CHHHHHHHHHHHCCCCCCCCCCCEEEEEEEEECCCHH
T ss_conf             87------------78745----------1002556752421245544577646434778515647