HHsearch alignment for GI: 255764460 and conserved domain: TIGR03265

>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transport system, ATP-binding protein component. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.
Probab=96.93  E-value=0.0085  Score=37.25  Aligned_cols=42  Identities=29%  Similarity=0.449  Sum_probs=32.0

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             7268807999706872378999999875200898799997388
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEH  105 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~  105 (363)
T Consensus        26 ~v~~Ge~~~llGpSG~GKtTlL-r~iaGl~~p~~G~I~~~g~~   67 (353)
T TIGR03265        26 SVKKGEFVCLLGPSGCGKTTLL-RIIAGLERQTAGTIYQGGRD   67 (353)
T ss_pred             EECCCCEEEEECCCCCHHHHHH-HHHHCCCCCCCEEEEECCEE
T ss_conf             9989999999999953599999-99976999987399999999