HHsearch alignment for GI: 255764460 and conserved domain: TIGR03269

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=96.91  E-value=0.032  Score=33.64  Aligned_cols=55  Identities=11%  Similarity=0.157  Sum_probs=30.2

Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             9999999997448976899814333220265543455530224788876776777764201781899986341
Q gi|255764460|r  132 QALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMR  204 (363)
Q Consensus       132 ~~~~i~~~li~~~~~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k~~~~~i~iNQ~r  204 (363)
T Consensus       175 Qrv~IA~aL~~~--P~lLilDEPTa~-----LD~-------~~~~~l----~~~l~~l~~~~g~tii~isH~l  229 (520)
T TIGR03269       175 QRVVLARQLAKE--PFLFLADEPTGT-----LDP-------QTAKLV----HNALEEAVKASGISMVLTSHWP  229 (520)
T ss_pred             HHHHHHHHHHCC--CCEEEEECCCCC-----CCH-------HHHHHH----HHHHHHHHHHHCCEEEEECCCH
T ss_conf             889999998459--989997076335-----799-------999999----9999999998396599974869