HHsearch alignment for GI: 255764460 and conserved domain: TIGR03420

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=97.22  E-value=0.0017  Score=41.64  Aligned_cols=85  Identities=19%  Similarity=0.352  Sum_probs=50.3

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCC--CHHHHHHH-CCC---HHHEE--EEECCCHHHHHHH
Q ss_conf             6880799970687237899999987520089879999738855--66889981-988---33448--9725848999999
Q gi|255764460|r   65 PKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHAL--DSIYARKL-GVD---LKNLL--ISQPDTGEQALEI  136 (363)
Q Consensus        65 p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~--~~~~a~~~-Gvd---~~~l~--~~~~~~~E~~~~i  136 (363)
T Consensus        36 ~~~~~l~i~G~~GsGKTHLl~a~~~~~~~~~~~~~yl~~~~~~~~~~~~l~~l~~~d~l~iDDi~~i~~~~~~e~~lF~l  115 (226)
T TIGR03420        36 KGDRFLYLWGESGSGKSHLLQAACAAAEERGKSAIYLPLAELAQADPEVLEGLEQADLVCLDDVEAIAGQPEWQEALFHL  115 (226)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHCCCCCEEEEECHHHHCCCHHHHHHHHHH
T ss_conf             68886999899999889999999999862699579952999877539999727448999996633343783789999999


Q ss_pred             HHHHHHCCCCCEEE
Q ss_conf             99997448976899
Q gi|255764460|r  137 TDMLVRSGAVDIIV  150 (363)
Q Consensus       137 ~~~li~~~~~~liV  150 (363)
T Consensus       116 ~N~~~~~~~-~ili  128 (226)
T TIGR03420       116 YNRVREAGG-RLLI  128 (226)
T ss_pred             HHHHHHHCC-EEEE
T ss_conf             999986528-2898