HHsearch alignment for GI: 255764460 and conserved domain: TIGR03498

>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI. Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively.
Probab=97.81  E-value=0.00039  Score=45.71  Aligned_cols=111  Identities=17%  Similarity=0.237  Sum_probs=68.2

Q ss_pred             CCCCCCCCCHHHHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCC-HHHHHHH-C---CC
Q ss_conf             65501477278999723897268807999706872378999999875200898799997388556-6889981-9---88
Q gi|255764460|r   44 GIEVVSSGSLGLDIALGIGGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALD-SIYARKL-G---VD  118 (363)
Q Consensus        44 ~~~~i~TG~~~lD~~Lg~GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~~-~~~a~~~-G---vd  118 (363)
T Consensus       120 i~e~l~TGIraID~l~p---ig~GQRigIfgg~GvGKt~Ll~~i~~~~~-adv~V~aliGeRgrEv~efi~~~~~~~~l~  195 (418)
T TIGR03498       120 VGEPLDTGVRVIDTFLP---LCRGQRLGIFAGSGVGKSTLLSMLARNTD-ADVVVIALVGERGREVREFLEDDLGEEGLK  195 (418)
T ss_pred             CCCCCCCCCCHHHHCCC---CCCCCEEECCCCCCCCHHHHHHHHHHHCC-CCEEEEEEEEEEHHHHHHHHHHHHHCCCCC
T ss_conf             88743157602120155---02576641137899988899999987507-986899883026899999999865315644


Q ss_pred             HHHEEEEECC--------CHHHHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             3344897258--------489999999999744897689981433322
Q gi|255764460|r  119 LKNLLISQPD--------TGEQALEITDMLVRSGAVDIIVIDSVAALT  158 (363)
Q Consensus       119 ~~~l~~~~~~--------~~E~~~~i~~~li~~~~~~liViDSi~al~  158 (363)
T Consensus       196 ~tvvv~atsd~p~~~R~~a~~~a~aiAEyFrd~G~~VLl~~Dsltr~A  243 (418)
T TIGR03498       196 RSVVVVATSDESPLMRRQAAYTATAIAEYFRDQGKDVLLLMDSVTRFA  243 (418)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHH
T ss_conf             269999448898788888887877899999867983899955725889