HHsearch alignment for GI: 255764460 and conserved domain: cd00550

>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This ATPase is involved in transport of arsenite, antimonite or other oxyanions across biological membranes in all three kingdoms of life. ArsA contains a highly conserved AAA motif present in the AAA+ ATPase superfamily associated with a variety of cellular activities. To form a functional ATP-driven pump, ArsA interacts with the permease ArsB, which is a channel-forming integral membrane protein. One of the most interesting features of ArsA is the allosteric activation by its transport substrates. A divalent cation, typically Mg2+, is required for its enzymatic activity.
Probab=97.02  E-value=0.012  Score=36.42  Aligned_cols=39  Identities=26%  Similarity=0.331  Sum_probs=34.8

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCC
Q ss_conf             079997068723789999998752008987999973885
Q gi|255764460|r   68 RIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHA  106 (363)
Q Consensus        68 ri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~  106 (363)
T Consensus         1 r~i~~~GKGGVGKTT~AaalA~~lA~~G~kVLlvstDPa   39 (254)
T cd00550           1 RYIFFGGKGGVGKTTISAATAVRLAEQGKKVLLVSTDPA   39 (254)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             989996898554899999999999968994999958986