HHsearch alignment for GI: 255764460 and conserved domain: cd01125

>cd01125 repA Hexameric Replicative Helicase RepA. RepA is encoded by a plasmid, which is found in most Gram negative bacteria. RepA is a 5'-3' DNA helicase which can utilize ATP, GTP and CTP to a lesser extent.
Probab=99.15  E-value=1.9e-09  Score=79.33  Aligned_cols=188  Identities=19%  Similarity=0.226  Sum_probs=109.6

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHH------------HCCCEEEEEECCCCCCH--HHH----HHHCCC-H-HHEEEE-
Q ss_conf             80799970687237899999987520------------08987999973885566--889----981988-3-344897-
Q gi|255764460|r   67 GRIVEIYGPESSGKTTLALHTIAQSQ------------KTGGTCAFVDAEHALDS--IYA----RKLGVD-L-KNLLIS-  125 (363)
Q Consensus        67 Gri~ei~G~~~sGKTtlal~~~a~~q------------k~g~~~~~iD~E~~~~~--~~a----~~~Gvd-~-~~l~~~-  125 (363)
T Consensus         1 G~v~~l~g~gG~GKS~lal~lAl~vA~G~~~~g~~~~~~~~G~Vly~~~Ed~~~~l~rRl~a~~~~~~~~~~~~rl~~~~   80 (239)
T cd01125           1 GYVSALVAPGGTGKSSLLLVLALAMALGKNLFGGGLKVTEPGRVVYLSAEDPREEIHRRLEAILQHLEPDDAGDRLFIDS   80 (239)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCCEEECC
T ss_conf             93899980899888999999999997599656898546877619999788998999999999998638665554166415


Q ss_pred             ---EC------C--CHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             ---25------8--489999999999744897689981433322026554345553022478887677677776420178
Q gi|255764460|r  126 ---QP------D--TGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSK  194 (363)
Q Consensus       126 ---~~------~--~~E~~~~i~~~li~~~~~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k~~  194 (363)
T Consensus        81 ~~~~~l~~~~~~~~~~~~~~~~i~~~~~~~~~~LVViDpL~~~~~-----~d--EN----d~~~m~~~i~~l~~ia~~tg  149 (239)
T cd01125          81 GRIQPISIAREGRIIVVPEFERIIEQLLIRRIDLVVIDPLVSFHG-----VS--EN----DNGAMDAVIKALRRIAAQTG  149 (239)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCHHHCC-----CC--CC----CHHHHHHHHHHHHHHHHHCC
T ss_conf             566644133577210148999999997458998999838177489-----99--78----89999999999999999719


Q ss_pred             CEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCC---CC--CCCEEEEEEEEEEEEECCCCCCCCE
Q ss_conf             18999863411456654665125655311111124897504553---44--5772476799987740577898515
Q gi|255764460|r  195 CILVFINQMRMKIGVMFGSPETTTGGNALKFYSSVRLDIRRVGS---IK--DKDSITGNQTRVKVVKNKMASPFKQ  265 (363)
Q Consensus       195 ~~~i~iNQ~r~~ig~m~g~p~~~~GG~al~~~aS~rl~i~k~~~---ik--~~~~~iG~~v~~kv~Knk~~~P~~~  265 (363)
T Consensus       150 ~aVl~vHHt~K~~~~~~~~~~a~RGaSaLvd~aR~~~~l~~m~~~ea~~~gi~~~~~~~~~r~~~~k~n~~~~~~~  225 (239)
T cd01125         150 AAILLVHHVRKGSAKDGDTQEAARGASALVDGARWVRALTRMTSEEAEKMGVGKAQPGLFFRFGVSKKNNAAATEA  225 (239)
T ss_pred             CEEEEEECCCCCCCCCCHHHHCCCCHHHHHHHHHHHHHHHCCCHHHHHHCCCCHHCCCCEEEECCCCCCCCCCCCC
T ss_conf             9999970688767887104434664877432354766773799999998299801068769963431026999976