HHsearch alignment for GI: 255764460 and conserved domain: cd02038

>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily. It shares the common function as an ATPase, with the ATP-binding domain at the N-terminus. In Pseudomonas aeruginosa, FleN gene is involved in regulating the number of flagella and chemotactic motility by influencing FleQ activity.
Probab=96.89  E-value=0.014  Score=35.84  Aligned_cols=39  Identities=26%  Similarity=0.321  Sum_probs=33.1

Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCC
Q ss_conf             799970687237899999987520089879999738855
Q gi|255764460|r   69 IVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHAL  107 (363)
Q Consensus        69 i~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~~~  107 (363)
T Consensus         2 i~v~sgKgGvGkt~~~~nLa~~la~~G~~vll~D~D~g~   40 (139)
T cd02038           2 IAVTSGKGGVGKTNISANLALALAKLGKRVLLLDADLGL   40 (139)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             899649999839999999999999789969999898999