HHsearch alignment for GI: 255764460 and conserved domain: cd03114

>cd03114 ArgK-like The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.
Probab=97.26  E-value=0.0032  Score=39.91  Aligned_cols=93  Identities=20%  Similarity=0.280  Sum_probs=56.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHCCCEEEEE--ECCCCC-------CHHHHHHHCCCHHHEEEEECCC-----HHHHHH
Q ss_conf             99970687237899999987520089879999--738855-------6688998198833448972584-----899999
Q gi|255764460|r   70 VEIYGPESSGKTTLALHTIAQSQKTGGTCAFV--DAEHAL-------DSIYARKLGVDLKNLLISQPDT-----GEQALE  135 (363)
Q Consensus        70 ~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~i--D~E~~~-------~~~~a~~~Gvd~~~l~~~~~~~-----~E~~~~  135 (363)
T Consensus         2 iGitG~pGaGKStLi~~l~~~~~~~g~~VaVlavDPsS~~sgGalLGDRiRm~~~~~~~~vfiRs~atrg~~ggla~~~~   81 (148)
T cd03114           2 IGITGVPGAGKSTLIDALITALRARGKRVAVLAIDPSSPFSGGAILGDRIRMERHASDPGVFIRSLATRGFLGGLSRATP   81 (148)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHH
T ss_conf             76258997878999999999999789837999968887866862032354534415799836863466665420468899


Q ss_pred             HHHHHHHCCCCCEEEEECCCCCCCHHHHH
Q ss_conf             99999744897689981433322026554
Q gi|255764460|r  136 ITDMLVRSGAVDIIVIDSVAALTPRAEIE  164 (363)
Q Consensus       136 i~~~li~~~~~~liViDSi~al~p~~Eie  164 (363)
T Consensus        82 ~~i~~l~~~g~D~IiIETvGvGQ--se~~  108 (148)
T cd03114          82 EVIRVLDAAGFDVIIVETVGVGQ--SEVD  108 (148)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCC--CHHH
T ss_conf             99999997599989997487775--6026