HHsearch alignment for GI: 255764460 and conserved domain: cd03215

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=97.20  E-value=0.0058  Score=38.30  Aligned_cols=122  Identities=19%  Similarity=0.296  Sum_probs=62.8

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCC--CCCHHHHHHHCCCH-----------------HHEE
Q ss_conf             7268807999706872378999999875200898799997388--55668899819883-----------------3448
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEH--ALDSIYARKLGVDL-----------------KNLL  123 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E~--~~~~~~a~~~Gvd~-----------------~~l~  123 (363)
T Consensus        22 ~v~~GEi~~liG~nGaGKSTll~~l~G~~~p~~G~I~-~~G~~~~~~~~~~~~~~~i~~vp~~r~~~~l~~~~~v~en~~  100 (182)
T cd03215          22 EVRAGEIVGIAGLVGNGQTELAEALFGLRPPASGEIT-LDGKPVTRRSPRDAIRAGIAYVPEDRKREGLVLDLSVAENIA  100 (182)
T ss_pred             EECCCCEEEEECCCCCCCCHHHHHHCCCCCCCCCEEE-ECCEECCCCCHHHHHHCCEEEEEHHHHHCCCCCCCCHHHHHH
T ss_conf             9859969999888999926377876698678877599-999998864999999789699602076625678990999951


Q ss_pred             EEECCC-HH-HHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEE
Q ss_conf             972584-89-9999999997448976899814333220265543455530224788876776777764201781899986
Q gi|255764460|r  124 ISQPDT-GE-QALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFIN  201 (363)
Q Consensus       124 ~~~~~~-~E-~~~~i~~~li~~~~~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k~~~~~i~iN  201 (363)
T Consensus       101 ~~~~LSGG~~Qrv~lAral~~--~p~llllDEPT~-----gLD~-------~~~-~~i~~~i~~----l~~~g~tvi~is  161 (182)
T cd03215         101 LSSLLSGGNQQKVVLARWLAR--DPRVLILDEPTR-----GVDV-------GAK-AEIYRLIRE----LADAGKAVLLIS  161 (182)
T ss_pred             CCCCCCHHHHHHHHHHHHHHC--CCCEEEECCCCC-----CCCH-------HHH-HHHHHHHHH----HHHCCCEEEEEE
T ss_conf             855799899999999999971--999999868754-----5899-------999-999999999----997899999996


Q ss_pred             CCC
Q ss_conf             341
Q gi|255764460|r  202 QMR  204 (363)
Q Consensus       202 Q~r  204 (363)
T Consensus       162 Hdl  164 (182)
T cd03215         162 SEL  164 (182)
T ss_pred             CCH
T ss_conf             879