HHsearch alignment for GI: 255764460 and conserved domain: cd03222

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=97.52  E-value=0.0014  Score=42.26  Aligned_cols=110  Identities=21%  Similarity=0.278  Sum_probs=60.8

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECC-CCCCHHHHHHHCCCHHHEEEEECCCHH-HHHHHHHHH
Q ss_conf             726880799970687237899999987520089879999738-855668899819883344897258489-999999999
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE-HALDSIYARKLGVDLKNLLISQPDTGE-QALEITDML  140 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E-~~~~~~~a~~~Gvd~~~l~~~~~~~~E-~~~~i~~~l  140 (363)
T Consensus        21 ~v~~GEiv~ilGpNGaGKSTllk~i~G~l~p~~G~i~~-~g~~~~~~pq~~-------------~LSGGqrQRv~iAral   86 (177)
T cd03222          21 VVKEGEVIGIVGPNGTGKTTAVKILAGQLIPNGDNDEW-DGITPVYKPQYI-------------DLSGGELQRVAIAAAL   86 (177)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEE-CCCCEECCCCCC-------------CCCHHHHHHHHHHHHH
T ss_conf             55899899998999999999999996886788994666-686122155515-------------0798999999999998


Q ss_pred             HHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             7448976899814333220265543455530224788876776777764201781899986341
Q gi|255764460|r  141 VRSGAVDIIVIDSVAALTPRAEIEGDMGESLPGMQARLMSQALRKLTSSISRSKCILVFINQMR  204 (363)
Q Consensus       141 i~~~~~~liViDSi~al~p~~Eie~~~~d~~~g~~ar~ms~~lrkl~~~~~k~~~~~i~iNQ~r  204 (363)
T Consensus        87 ~~~--p~lllLDEPt-----s~LD-----------~~~r~~i~~~ik~l~~~~~~Tvl~vsHdl  132 (177)
T cd03222          87 LRN--ATFYLFDEPS-----AYLD-----------IEQRLNAARAIRRLSEEGKKTALVVEHDL  132 (177)
T ss_pred             HCC--CCEEEECCCC-----CCCC-----------HHHHHHHHHHHHHHHHHCCCEEEEECCCH
T ss_conf             239--9999974886-----5389-----------99999999999999996597799985889