HHsearch alignment for GI: 255764460 and conserved domain: cd03231

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter. The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=96.80  E-value=0.025  Score=34.31  Aligned_cols=37  Identities=30%  Similarity=0.497  Sum_probs=27.2

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHHHHH-CCCEEEE
Q ss_conf             7268807999706872378999999875200-8987999
Q gi|255764460|r   63 GFPKGRIVEIYGPESSGKTTLALHTIAQSQK-TGGTCAF  100 (363)
Q Consensus        63 G~p~Gri~ei~G~~~sGKTtlal~~~a~~qk-~g~~~~~  100 (363)
T Consensus        22 ~i~~Ge~~~l~G~NGsGKSTLl-k~i~Gl~~p~sG~i~~   59 (201)
T cd03231          22 TLAAGEALQVTGPNGSGKTTLL-RILAGLSPPLAGRVLL   59 (201)
T ss_pred             EECCCCEEEEECCCCCCHHHHH-HHHHCCCCCCCEEEEE
T ss_conf             8879959999999999999999-9996677888529999