>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substra

Probab=97.51 E-value=0.0014 Score=42.16 Aligned_cols=90 Identities=23% Similarity=0.281 Sum_probs=54.5 Q ss_pred CCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECC--CCCCHH-HHHHHCCCHHHEEEEECCCHH------- Q ss_conf 9726880799970687237899999987520089879999738--855668-899819883344897258489------- Q gi|255764460|r 62 GGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAE--HALDSI-YARKLGVDLKNLLISQPDTGE------- 131 (363) Q Consensus 62 GG~p~Gri~ei~G~~~sGKTtlal~~~a~~qk~g~~~~~iD~E--~~~~~~-~a~~~Gvd~~~l~~~~~~~~E------- 131 (363) T Consensus 23 l~i~~G~~vaIvG~sGsGKSTLl~ll~gl~~p~~G~i~-i~g~~~~~~~~~~~~~~i~~v~Q~~~lf~-~ti~eNiLSGG 100 (173) T cd03246 23 FSIEPGESLAIIGPSGSGKSTLARLILGLLRPTSGRVR-LDGADISQWDPNELGDHVGYLPQDDELFS-GSIAENILSGG 100 (173) T ss_pred EEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEE-ECCEECCCCCHHHHHCCEEEEECCCEECC-CCHHHHCCCHH T ss_conf 99859999999999998099999999666667999899-99999332899898420899908883677-75899767699 Q ss_pred --HHHHHHHHHHHCCCCCEEEEECCC Q ss_conf --999999999744897689981433 Q gi|255764460|r 132 --QALEITDMLVRSGAVDIIVIDSVA 155 (363) Q Consensus 132 --~~~~i~~~li~~~~~~liViDSi~ 155 (363) T Consensus 101 QkQRvalARal~~~--p~ililDEpt 124 (173) T cd03246 101 QRQRLGLARALYGN--PRILVLDEPN 124 (173) T ss_pred HHHHHHHHHHHHCC--CCEEEEECCC T ss_conf 99999999998279--9999996876

HHsearch alignment for GI: 255764460 and conserved domain: cd03246